Additional information available:

DISABLEENABLESETSHOWUSEWRITE

Parameters

    DISABLE CHECKS
   Bypasses validation of parameter values. SYSMAN parameter
   validation consists of ensuring that the parameters fall within
   the defined minimum and maximum values specified in the PARAMETERS
   SET command.

   Format

     PARAMETERS DISABLE CHECKS

Additional information available:

Example

   SYSMAN> SET ENVIRONMENT/CLUSTER
   SYSMAN> SET PROFILE/DEFAULT=SYS$SYSTEM/PRIVILEGES=CMEXEC
   SYSMAN> PARAMETERS SET MAXPROCESSCNT 10
   %SMI-E-OUTRANGE, parameter is out of range
   SYSMAN> PARAMETERS DISABLE CHECKS
   SYSMAN> PARAMETERS SET MAXPROCESSCNT 10

     In this example, the initial attempt to set MAXPROCESSCNT
     below the minimum fails because range checks are enabled.
     However, once range checks are disabled, the PARAMETERS SET
     MAXPROCESSCNT command succeeds.

    ENABLE CHECKS

   Validates all parameter values to ensure they fall within the
   defined minimum and maximum values.

   Because range checks are enabled by default, use PARAMETERS ENABLE
   CHECKS after entering a PARAMETERS DISABLE CHECKS command.

   Format

     PARAMETERS ENABLE CHECKS

Additional information available:

Example

   SYSMAN> PARAMETERS DISABLE CHECKS
   SYSMAN> PARAMETERS SET WSMAX 20
   SYSMAN> PARAMETERS ENABLE CHECKS
   SYSMAN> PARAMETERS SET WSMAX 30
   %SMI-E-OUTRANGE, parameter is out of range
   SYSMAN> PARAMETERS SHOW WSMAX
   Parameter Name    Current  Default  Minimum  Maximum Unit  Dynamic
   WSMAX                2000     1024       60   6400 pages

     The PARAMETERS ENABLE CHECKS command in this example
     illustrates that when range checking is disabled, the system
     accepts a working set value (WSMAX) of 20. However, once range
     checking is enabled with the PARAMETERS ENABLE CHECKS command,
     the system does not accept a WSMAX below the minimum, which is
     60.

   Changes the value of a specific parameter in the work area.

   The PARAMETERS SET command does not modify parameter files, the
   current system parameter file on disk, or the active system. For
   information on performing these modifications, see the PARAMETERS
   WRITE command.

   Format

     PARAMETERS SET  parameter-name

                     value

                     /STARTUP filespec

Additional information available:

ParametersQualifierExamples

parameter-name
   Specifies the name of the parameter to modify. Instead of a
   name, you can enter a period (.)  to change the value of the most
   recently displayed or the most recently modified parameter. See
   the PARAMETERS SHOW command for an example of using the period in
   place of a parameter name.

   For a list of system parameters and further information on them,
   use the command HELP PARAMETERS.

value
   Specifies the new value for the parameter. Enclose values for
   ASCII parameters in quotation marks if they contain embedded
   spaces or other special characters.

   Typically the value is an integer or the keyword DEFAULT. The
   keyword DEFAULT sets the parameter to its default value. The
   PARAMETERS SHOW command displays the defined minimum, maximum,
   and default values for the parameter, which are required unless
   range checking is disabled with the command PARAMETERS DISABLE
   CHECKS.

Additional information available:

/STARTUP

      /STARTUP filespec

   Sets the name of the site-independent startup procedure to the
   given file specification. A file specification has a maximum
   length of 31 characters. The initial startup command procedure
   is SYS$SYSTEM:STARTUP.COM.

   1.  SYSMAN> PARAMETERS SET PFCDEFAULT 20

     The PARAMETERS SET command in this example assigns a value of
     20 to the PFCDEFAULT parameter.

   2.  SYSMAN> PARAMETERS SET GBLSECTIONS DEFAULT

     The PARAMETERS SET command in this example assigns the default
     value (40) to the GBLSECTIONS parameter.


   3.  SYSMAN> PARAMETERS SET/STARTUP SYS$SYSTEM:XSTARTUP.COM

     The command in this example assigns SYS$SYSTEM:XSTARTUP.COM as
     the current site-independent startup command procedure.

   Displays the value of a parameter or a group of parameters in the
   work area. In addition, the command shows the minimum, maximum,
   and default values of a parameter and its unit of measure.

   Format

     PARAMETERS SHOW  [parameter-name]

Additional information available:

ParameterQualifiersexamples

parameter-name
   Specifies the name of a parameter or a period (.).  A period is
   interpreted as a request for the parameter specified in the last
   PARAMETERS SET or PARAMETERS SHOW command. The parameter name can
   be abbreviated, but the abbreviation must be unique because SYSMAN
   selects the first parameter that matches.

Additional information available:

/ACP/ALL/CLUSTER/DYNAMIC/GEN/HEX/JOB
/LGI/MAJOR/MULTIPROCESSING/NAMES/OUTPUT/PQL
/RMS/SCS/SPECIAL/STARTUP/SYS/TTY

   Displays all Files-11 ACP parameters.

   Displays the values of all active parameters.

   Displays all parameters specific to clusters.

   Displays all parameters that would be in effect immediately after
   you enter a PARAMETERS WRITE ACTIVE command.

   Displays all general parameters.

   Displays numeric parameters in hexadecimal rather than decimal
   radix. Specify the /HEX system parameter name or the parameter
   type. If you specify the /HEX qualifier with the /NAMES qualifier,
   /HEX is ignored.

   Displays all Job Controller parameters.

   Displays all LOGIN security control parameters.

   Displays the most important parameters.

   Displays parameters specific to multiprocessing.

   Displays only parameter names. You can combine other qualifiers
   with this one.

   Directs output to the specified file rather than SYS$OUTPUT.
   Without a file specification, the output goes to SYSMAN.LIS in
   the current directory.

   Displays the parameters for all default process quotas.

   Displays all parameters specific to VMS Record Management Services
   (VMS RMS).

   Displays all parameters specific to VAXcluster System
   Communication Services.

   Displays all special control parameters.

   Displays the name of the site-independent startup procedure.

   Displays all active system parameters.

   Displays all parameters for terminal drivers.

   1.  SYSMAN> PARAMETERS SHOW GBLSECTIONS

   Parameter Name    Current   Default   Minimum     Maximum Unit  Dynamic
   GBLSECTIONS           100        40        20     -1  Sections

       SYSMAN> PARAMETERS SET . 110
       SYSMAN> PARAMETERS SHOW .

   Parameter Name    Current   Default   Minimum     Maximum Unit  Dynamic
   GBLSECTIONS           110        40        20     -1  Sections

     In this example, the user first displays the values of the
     GBLSECTIONS parameter and then refers to the parameter
     with a period to set its current value to 110. The next
     PARAMETERS SHOW command also uses the period notation to obtain
     confirmation that the change occurred.

   2.  SYSMAN> PARAMETERS SHOW/ACP

     The PARAMETERS SHOW command in this example produces output
     similar to the following:


Parameters in use: Active
Parameter Name        Current   Default   Minimum   Maximum Unit  Dynamic
ACP_MULTIPLE                0         1         0         1 Boolean     D
ACP_SHARE                   1         1         0         1 Boolean
ACP_MAPCACHE               52         8         1        -1 Pages       D
ACP_HDRCACHE              138       128         2        -1 Pages       D
ACP_DIRCACHE              138        80         2        -1 Pages       D
ACP_DINDXCACHE             37        25         2        -1 Pages       D
ACP_WORKSET                 0         0         0        -1 Pages       D
ACP_FIDCACHE               64        64         0        -1 File-Ids    D
ACP_EXTCACHE               64        64         0        -1 Extents     D
ACP_EXTLIMIT              300       300         0      1000 Percent/10  D
ACP_QUOCACHE              130        64         0        -1 Users       D
ACP_SYSACC                  4         8         0        -1 Directories D
ACP_MAXREAD                32        32         1        64 Blocks      D
ACP_WINDOW                  7         7         1        -1 Pointers    D
ACP_WRITEBACK               1         1         0         1 Boolean     D
ACP_DATACHECK               2         2         0         3 Bit-mask    D
ACP_BASEPRIO                8         8         4        31 Priority    D
ACP_SWAPFLGS               14        15         0        15 Bit-mask    D
ACP_XQP_RES                 1         1         0         1 Boolean
ACP_REBLDSYS                0         1         0         1 Boolean


   3.  SYSMAN> PARAMETERS SHOW/ACP/HEX

     The PARAMETERS SHOW command in this example produces a
     hexadecimal display of the values of the ACP system parameters.

Parameters in use: Active
Parameter Name        Current   Default   Minimum   Maximum Unit  Dynamic
ACP_MULTIPLE         00000000  00000001  00000000  00000001 Boolean     D
ACP_SHARE            00000001  00000001  00000000  00000001 Boolean
ACP_MAPCACHE         00000034  00000008  00000001  FFFFFFFF Pages       D
ACP_HDRCACHE         0000008A  00000080  00000002  FFFFFFFF Pages       D
ACP_DIRCACHE         0000008A  00000050  00000002  FFFFFFFF Pages       D
ACP_DNDXCACHE        00000025  00000019  00000002  FFFFFFFF Pages       D
ACP_WORKSET          00000000  00000000  00000000  FFFFFFFF Pages       D
ACP_FIDCACHE         00000040  00000040  00000000  FFFFFFFF File-Ids    D
ACP_EXTCACHE         00000040  00000040  00000000  FFFFFFFF Extents     D
ACP_EXTLIMIT         0000012C  0000012C  00000000  000003E8 Percent/10  D
ACP_QUOCACHE         00000082  00000040  00000000  FFFFFFFF Users       D
ACP_SYSACC           00000004  00000008  00000000  FFFFFFFF Directories D
ACP_MAXREAD          00000020  00000020  00000001  00000040 Blocks      D
ACP_WINDOW           00000007  00000007  00000001  FFFFFFFF Pointers    D
ACP_WRITEBACK        00000001  00000001  00000000  00000001 Boolean     D
ACP_DATACHECK        00000002  00000002  00000000  00000003 Bit-mask    D
ACP_BASEPRIO         00000008  00000008  00000004  0000001F Priority    D
ACP_SWAPFLGS         0000000E  0000000F  00000000  0000000F Bit-mask    D
ACP_XQP_RES          00000001  00000001  00000000  00000001 Boolean
ACP_REBLDSYS         00000000  00000001  00000000  00000001 Boolean


   4.  SYSMAN> PARAMETERS SHOW/STARTUP
       Startup command file = SYS$SYSTEM:STARTUP.COM

     The PARAMETERS SHOW command in this example displays the name
     of the site-independent startup command procedure.

   Reads a set of system parameters into the work area for inspection
   or manipulation.

   Format

     PARAMETERS USE  source

Additional information available:

ParameterExample

source
   The source of a system parameter file for data to be read into the
   work area. The source can be any of the following:

   o  ACTIVE-Read parameters from the currently running system. When
      the work area is empty, this is the default.

   o  CURRENT-Read parameters from the disk image of the currently
      running system. Use of the CURRENT parameter requires read (R)
      access to SYS$SYSTEM:VAXVMSSYS.PAR.

   o  DEFAULT-Read a parameter set containing the default values for
      all parameters.

   o  filespec-Read parameters from a previously created system
      parameter file. The default file type is PAR. Use of the
      parameter requires read access to the file.

   SYSMAN> PARAMETERS USE DEFAULT

     The PARAMETERS USE command in this example initializes the work
     area with parameter values that should allow the VMS operating
     system to boot on any standard configuration. The initial
     values of the work area when the utility is invoked are the
     active values.

   Writes the contents of the work area to the specified destination.

   Format

     PARAMETERS WRITE  destination

Additional information available:

Parameterexamples

destination
   The destination of a new parameter file can be any of the
   following:

   o  ACTIVE-Write the parameter set to the currently running system.
      Use of the ACTIVE parameter requires the CMKRNL privilege.

   o  CURRENT-Write the parameter set to the disk image of the
      currently running system. The disk image is the current system
      parameter file on disk. Use of the CURRENT parameter requires
      write access to SYS$SYSTEM:VAXVMSSYS.PAR.

   o  filespec-Create the given file and write the parameter set
      to it. The default file type is PAR. Use of this parameter
      requires write access to the file.

   1.  SYSMAN> PARAMETERS WRITE SYS$SYSTEM:SPECIAL

     The command in this example creates a new parameter
     specification file.

   2.  SYSMAN> PARAMETERS WRITE CURRENT

     The command in this example modifies the current system
     parameter file on disk (SYS$SYSTEM:VAXVMSSYS.PAR).

Additional information available:

ACP_BASEPRIOACP_DATACHECKACP_DIRCACHEACP_DINDXCACHE
ACP_EXTCACHEACP_EXTLIMITACP_FIDCACHEACP_HDRCACHE
ACP_MAPCACHEACP_MAXREADACP_MULTIPLEACP_QUOCACHE
ACP_REBLDSYSDACP_SHAREACP_SWAPFLGSACP_SYSACC
ACP_WINDOWACP_WORKSETACP_WRITEBACKACP_XQP_RES
ALLOCLASSAWSMINAWSTIMEBALSETCNTBJOBLIM
BORROWLIMBUGCHECKFATALBUGREBOOTCLISYMTBL
CRDENABLEDEADLOCK_WAITDEFMBXBUFQUODEFMBXMXMSG
DEFPRIDEFQUEPRIDISK_QUORUMDISMOUMSG
DORMANTWAITDUMPBUGDUMPSTYLEERLBUFFERPAGES
ERRORLOGBUFFERSEXPECTED_VOTESEXTRACPUFREEGOALFREELIM
GBLPAGESGBLPAGFILGBLSECTIONSGROWLIMIJOBLIMINTSTKPAGES
IRPCOUNTIRPCOUNTVKFILSTCNTLAMAPREGSLGI_BRK_TERM
LGI_BRK_DISUSERLGI_BRK_LIMLGI_BRK_TMOLGI_HID_TIM
LGI_PWD_TMOLGI_RETRY_TMOLGI_RETRY_LIMLNMPHASHTBL
LNMSHASHTBLLOAD_PWD_POLICYLOAD_SYS_IMAGESLOCKDIRWT
LOCKIDTBLLOCKIDTBL_MAXLONGWAITLRPCOUNTLRPCOUNTV
LRPSIZEMAXBUFMAXPROCESSCNTMAXQUEPRIMAXSYSGROUP
MINWSCNTMMG_CTLFLAGSMOUNTMSGMPW_HILIMIT
MPW_IOLIMITMPW_LOLIMITMPW_LOWAITLIMITMPW_THRESH
MPW_WAITLIMITMPW_WRTCLUSTERMSCP_BUFFERMSCP_CREDITS
MSCP_LOADMSCP_SERVE_ALLMULTIPROCESSINGMVTIMEOUT
NISCS_CONV_BOOTNISCS_LOAD_PEA0NISCS_PORT_SERVNJOBLIM
NPAGEDYNNPAGEVIRPAGEDYNPAGFILCNTPAMAXPORTPANOPOLL
PANUMPOLLPAPOLLINTERVALPAPOOLINTERVALPASANITY
PASTDGBUFPASTIMOUTPFCDEFAULTPFRATH
PFRATLPQL_DASTLMPQL_MASTLMPQL_DBIOLM
PQL_MBIOLMPQL_DBYTLMPQL_MBYTLMPQL_DCPULM
PQL_MCPULMPQL_DDIOLMPQL_MDIOLMPQL_DFILLM
PQL_MFILLMPQL_DPGFLQUOTAPQL_MPGFLQUOTAPQL_DPRCLM
PQL_MPRCLMPQL_DTQELMPQL_MTQELMPQL_DWSDEFAULT
PQL_MWSDEFAULTPQL_DWSQUOTAPQL_MWSQUOTAPQL_DWSEXTENT
PQL_MWSEXTENTPQL_DENQLMPQL_MENQLMPQL_DJTQUOTA
PQL_MJTQUOTAPRCPOLINTERVALPROCSECTCNTQDSKINTERVAL
QDSKVOTESQUANTUMQUORUMREALTIME_SPTSRECNXINTERVAL
RESHASHTBLRJOBLIMRMS_DFMBCRMS_DFMBFSDK
RMS_DFMBFSMTRMS_DFMBFSURRMS_DFMBFRELRMS_DFMBFIDX
RMS_DFMBFHSHRMS_DFNBCRMS_EXTEND_SIZERMS_FILEPROT
RMS_GBLBUFQUORMS_PROLOGUESAVEDUMPSCSBUFFCNT
SCSCONNCNTSCSFLOWCUSHSCSMAXDGSCSMAXMSG
SCSNODESCSRESPCNTSCSSYSTEMIDSCSSYSTEMIDH
SETTIMESHADOWINGSHADOW_SYS_DISKSHADOW_SYS_UNIT
SHADOW_MAX_COPYSMP_CPUSSMP_LNGSPINWAITSMP_SANITY_CNT
SMP_SPINWAITSPTREQSRPCOUNTSRPCOUNTVSTARTUP_P1--8
SWPFILCNTSWPOUTPGCNTSYSMWCNTTAPE_ALLOCCLASS
TAPE_MVTIMEOUTTIMEPROMPTWAITTTY_SCANDELTATTY_SPEED
TTY_RSPEEDTTY_PARITYTTY_BUFTTY_DEFCHAR
TTY_DEFCHAR2TTY_TYPAHDSZTTY_ALTYPAHDTTY_ALTALARM
TTY_DMASIZETTY_CLASSNAMETTY_PROTTTY_OWNER
TTY_DIALTYPETTY_SILOTIMETTY_TIMEOUTTTY_AUTOCHAR
UDABURSTRATEUAFALTERNATEUSERVAXCLUSTER
VECTOR_MARGINVECTOR_PROCVIRTUALPAGECNTVOTES
WINDOW_SYSTEMWSDECWSINCWSMAXWS_OPA0XFMAXRATE

Special params

  ACP base priority.

  Data verification for ACP I/O operations. The following are possible
  values for ACP_DATACHECK:

          0     no checking
          1     read checking only
          2     write checking only
          3     read and write checking

  Number of blocks in file directory cache.

  ACP_DINDXCACHE controls the size of the  directory  index  cache  in
  order to minimize directory file access overhead;  builds  an  index
  into the directory file and maintains it.  This  parameter  replaces
  the ACP_SYSACC parameter for Files-11 ODS-2 disks.

  Number of cached disk extents.

  Maximum fraction of disk to cache in tenths of percent.

  Number of cached file identification slots.

  Number of blocks in file header cache.

  Number of blocks in bitmap cache - sets  the  number  of  pages  for
  caching bit map blocks.

  Maximum number of blocks to read at once for directories.

  Multiple ACP - specifies that separate ACPs are to  be  created  for
  each volume.

 Number of quota file entries to cache.

  ACP_REBLDSYSD specifies whether the system disk should be rebuilt if
  it was improperly dismounted.  The  default value "1" specifies that
  the system disk should be rebuilt while  booting.  The  value  of  0
  specifies that the disk should not  be  rebuilt  if  it  had  extent
  caching, file number caching,  or diskquota caching enabled. If this
  parameter is 0 the DCL command  SET VOLUME/REBUILD command should be
  issued after booting to rebuild the disk.

  Allows sharing of  ACP  code - enables  the  creation  of  a  global
  section for the first ACP used, so that succeeding  ACPs  may  share
  its code.

  ACP swap flags bit mask - Enable swapping of ACPs.

     Bit 0 set - allows swapping of system disk ACPs
     Bit 1 set - allows swapping of group disk ACPs
     Bit 2 set - allows swapping of private disks ACPs
     Bit 3 set - allows swapping of magtape ACPs

  Size of directory access cache - sets the number of directory file
  control blocks  that will be cached for system access disks.

  Default window size for system volumes.

  ACP working set in pages (0 means maximal).

  Deferred cache writeback enable.

  ACP_XQP_RES controls whether or not the XQP is memory-resident.  The
  default of 1 specifies that the XQP is memory-resident.

  ALLOCLASS determines the allocation class for the system.

  AWSMIN establishes the lowest number of pages to which a working set
  limit can be decreased by automatic working set adjustment.

  AWSTIME specifies the minimum amount of processor time that must
  elapse for the system to collect a significant sample of a working
  set's page fault rate. The time is expressed in units of 10 milli-
  seconds. The default value of 20, for example, is 200 milliseconds.

  Number of resident working sets - determines the maximum  number  of
  process that can be concurrently resident.

  Batch job limit - Maximum number of batch jobs allowed in the system
  at any time.

  Desired free list length that must exist to allow working set sizes
  to grow past WSQUOTA.

  Fatal  BUGCHECK  -  turns  all  continuable  BUGCHECKS  into  fatal
  BUGCHECKS.

  BUGCHECK reboot - enables automatic reboot on BUGCHECK.

  Command interpreter symbol table size - sets the size of the command
  interpreter symbol table.

  CRD error enable - enables detection and logging of memory CRD errors.

  Number of seconds a lock must wait before a deadlock search is
  initiated.

  Default buffer quota for Mailboxes.

  Default maximum Mailbox message size.

  Default priority - Default priority for job initiations.

  Establishes the scheduling priority for jobs entered  in  batch  and
  output (printer, server,  and  terminal)  queues  when  no  explicit
  scheduling priority is specified by the submitter. The value of this
  parameter can range from 0 to 255; the default value is 100.

  The cluster quorum disk name.

  Enables operator notification of volume dismounts.

  DORMANTWAIT specifies, in seconds,  the  amount  of  time  that  may
  elapse without a significant event before the system  treats  a  low
  priority computable process as  a  DORMANT  process  for  scheduling
  purposes. After SUSP  processes,  DORMANT  processes  are  the  most
  likely candidates for memory reclamation by the swapper.

  BUGCHECK dump enable - enable system dump on BUGCHECK.

  DUMPSTYLE specifies the desired method for taking system dumps
  on BUGCHECK.  DUMPSTYLE is a 32 bit mask with 2 defined values.
  The default value "0" specifies that the entire contents of
  physical memory will be written to the dump file.  Setting
  DUMPSTYLE to "1" specifies that the contents of memory will be
  written to the dump file selectively to maximize the utility
  of the dump file while conserving disk space.

  If the dump file is large enough to contain the entire contents
  of physical memory, DUMPSTYLE should be set to "0" to insure
  that all of the information in physical memory is saved in the
  dump file.

  If the dump file is too small to contain the entire contents
  of physical memory, DUMPSTYLE should be set to "1" to insure
  that the most important pieces of memory will be written to
  the dump file first and to maximize the chance that the dump
  file will contain enough information for successful analysis.

  ERLBUFFERPAGES dicates how many pages are allocated for each
  of the error log buffers. The number of buffers can be increased
  by altering ERRORLOGBUFFERS. Changing the former allows longer
  messages to be logged and changing the latter higher error rates
  to be serviced without loss of messages.

  Multiplying the two provides the memory demands
  (and the demands placed on the system dump file) for error log storage.

  ERRORLOGBUFFERS specifies the amount of physical memory (in pages)
  reserved for system error log entries.

  If ERRORLOGBUFFERS is too low, attempts to write messages to the
  error log file may fail. If ERRORLOGBUFFERS is too high, too many
  pages can be consumed by the error log buffers.

  If you increase ERRORLOGBUFFERS, you also need to increase the size
  of the system dump file by an equal amount. For example, if you
  increase ERRORLOGBUFFERS from 4 (the default) to 6, you must also
  increase the size of the dump file by 2 blocks.

  Normally the default value for ERRORLOGBUFFERS is adequate.

  Indicates the maximum number of votes that may be present  in  a
  VAXcluster at any given time.  Set it to a value that is equal to
  the sum of the vote parameters of all VAXcluster members, plus any
  votes that are contributed by the quorum disk.  This value is used
  to automatically derive the number of votes that must be present
  for the VAXcluster to function (quorum).

  Extra CPU time - This parameter sets the number of 10 millisecond
  units to be allowed as an extension when CPU time expires.  One
  extension is allowed for each access mode.

  Target free list length - specifies the number of free pages that the
  swapper will attempt to make available when trolling is enabled and
  the free list drops below this value, or when correcting for free list
  size less than FREELIM.

  Lower limit of the free page list - The minimum number of pages that
  must remain free on the free page list.

  Global page table entry count - establishes the size of the global page
  table and the limit for the total number of global pages that can be
  created.

  Global page file limit - establishes the maximum number of global pages
  with page file backing store that can be created.

  Global section descriptor count - determines the maximum number  of
  global sections which can be made known to the system by allocating
  the necessary storage for the GST entries.

  Desired free list length that must exist to allow processes to  add
  pages to their working sets past WSQUOTA. This parameter is used at
  the actual time  of  adding pages to the individual process working
  set.  This  prevents many processes from being allowed to grow past
  WSQUOTA as computed by BORROWLIM.

 Interactive job limit - Maximum number of interactive jobs allowed
 in the system at any time.

  Interrupt stack size - Establishes the size of the interrupt stack in
  pages.

  Count of pre-allocated I/O packets - determines the number of I/O
  packets to be pre-allocated and linked together for fast allocation
  and deallocation.

  Virtual IRP count - Number of packets to which the IRP list may be
  extended.

  Number of known file list heads - establishes the maximum number of
  known file lists that can be made known to the system.

  Number of Unibus map registers to preallocate for LPA11 - sets the
  number of unibus map resisters allocated to an LPA11 when the driver
  is loaded.

  When set, causes the terminal name to be part of the association string
  for the terminal mode of breakin detection. When not set, association is
  done on username only. Set by default, should be  cleared  if  physical
  terminal names are created dynamically(e.g., as LAT does) and effective
  breakin detection is wanted.

  When set, turns on the DISUSER flag in the UAF record whn an attempted
  breakin is detected, thus permanently locking out that account. Clear by
  default, only set this if you are very paranoid about attempted breakins;
  severe denial of services are a potential side effect.

  LGI_BRK_LIM specifies the number of failures that may occur at login time
  before the system will take action against a possible breakin.

  LGI_BRK_TMO specifies the number of seconds that a user, terminal, or node
  is permitted to attempt a login before the system assumes that a breakin
  attempt is occurring and evasive action is required.

  LGI_HID_TIM specifies the number of seconds that evasive action will
  persist following the detection of a possible breakin  attempt.  The
  evasive action consists of refusing to allow any logins during  this
  period, regardless of whether a valid user  name  and  password  are
  specified.

  Period of time, in seconds, a user has to correctly enter the system
  password on a terminal on which the system password is in effect.

  LGI_RETRY_TMO specifies the number of seconds allowed between  login
  retry attempts after a login failure.

 LGI_RETRY_LIM specifies the number of retry attempts allowed for users
 attempting to login over dialup lines.

 Logical name hash table -  Size of PROCESS logical name hash table.

 Logical name hash table - Size of SYSTEM logical name hash table.

 LOAD_PWD_POLICY controls whether or not the SET  PASSWORD utility
 attempts to use site-specific password policy routines, which are
 contained in the shareable image SYS$LIBRARY:VMS$PASSWORD_POLICY.EXE.
 The default is 0.

 LOAD_SYS_IMAGES controls the loading of system images described in
 the system image data file, VMS$SYSTEM_IMAGES.DATA. For VMS Version
 5.4 of the operating system, you can replace three system services
 with services specific to your site:

 o  $ERAPAT-generates a security erase pattern

 o  $MTACCESS-controls magnetic tape access

 o  $HASH_PASSWORD-applies a hash algorithm to an ASCII password

 You can set the parameter of LOAD_SYS_IMAGES to 0 during SYSBOOT in
 case you have difficulty booting with the site-specific system
 services and do not want the site-specific system services loaded.
 The default is 1.

 LOCKDIRWT (lock manager directory system weight) determines the portion
 of lock manager directory which will be handled by this system.

 Size of lock ID table.

 LOCKIDTBL_MAX establishes the maximum size of the Lock ID table.

 Elapsed realtime to cause a HIB or LEF process look like it is in
 longwait - This parameter sets the number of one second units
 that need to have elapsed.  Longwait processes are the most eligible
 to attempt to recover pages from when a shortage is detected.

 Number of large request packets to allocate to the LRP look aside list.

 Virtual IRP count - Number of LRP's to which the LRP list may be extended.

 Large request packet size - Number of bytes to allocate to an LRP.

 Maximum size of a buffered I/O transfer -  Maximum number of bytes
 that can be transfered in one buffered I/O request.

 Maximum number of processes - establishes the maximum number of processes
 on the system.

 Determines the highest scheduling priority that can be assigned
 to jobs entered in batch and output (printer, server, and terminal) queues
 without the submitter process having OPER or ALTPRI privilege. The value
 of this parameter can range from 0 to 255; the default value is 100.

 Highest system UIC - The highest value that a group number can have
 and still be classified as a a system UIC group member.  In decimal.

 Minimum working set size - sets the minimum number of fluid pages---that
 is, pages not locked in the working set---required for the execution of
 a process. This value, plus the size of the process header, establishes
 the minimum working set size.

 Enables/disables proactive memory reclamation mechanisms. Bit 0 controls
 the ticking function which reclaims memory from periodically executing,
 but otherwise idle processes when the size of the free list drops below
 2 X FREEGOAL. Bit 1 controls the Swapper's trolling function which
 reclaims memory from truly idle processes when the size of the free list
 drops below FREEGOAL. Bits 2-7 are reserved for future use.

 Enables operator notification of volume mounts.

 Modified page list maximum limit - threshold at which to begin writing
 modified pages.

 Number of outstanding I/Os to the modified page writer. Prior to
 VMS Version 5.0, the modified page writer never had more than one
 I/O outstanding at a time. For VMS V5.0, the modified page writer
 can have up to 127 I/Os outstanding. The default is 4.

 Each I/O requires a permanent, non-paged pool allocation equal to
 an I/O request packet + (6 * MPW_WRTCLUSTER) bytes.  With the default
 MPW_WRTCLUSTER of 96, for example, the required allocation per
 I/O is 752 bytes.

 Modified page list low limit - threshold at which modified page writing
 will normally stop.  Writing started at the high limit and pages
 are written in chunks controlled by the cluster factor.

 Modified page list low wait limit - threshold at which processes in
 the miscellaneous wait state MPWBUSY are allowed to resume.  Prior
 to VMS Version 5.0, processes were not removed from the MPWBUSY wait
 state until the size of the modified page list was reduced to
 MPW_LOLIMIT.  MPW_LOWAITLIMIT increases system performance for fast
 processors with large memories by reducing the amount of time
 processes spend in the MPWBUSY wait state.

 Modified page writer threshold - Lower limit threshold stopping the use
 of the modified page writer from being used as the primary mechanism
 to recover memory.

 Modified page writer busy wait limit - Threshold of when to put a process
 into resource wait if it is generating a modified page and the size of
 the modified list is greater than this parameter.

  Number of pages written per I/O  from modified page list - specifies
  the number of pages to attempt to write from the modified page list
  as a single contiguous I/O transfer to disk.

  MSCP_BUFFER specifies the amount of memory (in pages) to be allocated to
  the MSCP server's local buffer area. The buffer area is the space used
  by the server to transfer data between client systems and local disks.

  MSCP_CREDITS specifies the maximum number of outstanding I/O requests
  that can be active from each client system.

  MSCP_LOAD controls the loading of the MSCP server during a system
  boot. Specify one of the following values:

        0     Do not load the MSCP server. This is the default value.

        1     Load the MSCP server and serve disks as specified by the
              MSCP_SERVE_ALL parameter.

  MSCP_SERVE_ALL controls the serving of disks during a system boot.
  Specify one of the following values:

        0      Do not serve any disks. This is the default.

        1      Serve all available disks.

        2      Serve only locally-attached (non-HSC) disks.

  If the MSCP_LOAD system parameter is zero, MSCP_SERVE_ALL is ignored.

  MULTIPROCESSING controls loading of the system synchronization image.
  Specify one of the following values:

        0     Load uniprocessing synchronization image.

        1     Load full-checking multiprocessing synchronization  image
              if CPU type is  capable  of  SMP and two or more CPUs are
              present on the system.

        2     Always  load  full-checking version, regardless of system
              configuration or CPU availability

        3     Load streamlined multiprocessing synchronization image if
              CPU type is capable of SMP  and  two  or  more  CPUs  are
              present on the system.

 Mount verification timeout.

  NISCS_CONV_BOOT controls whether or not  a  conversational  boot  is
  permitted during a remote system boot.  The  default of 0 indicates
  that conversational boots are not permitted.

  NISCS_LOAD_PEA0 controls whether the NI-SCS port driver PEDRIVER
  is loaded during system boot. The default of 0 indicates that the
  PEDRIVER is not loaded.

  NISCS_PORT_SERV provides flag bits for PEDRIVER port services. Bits
  0 and 1 set (decimal value 3) enables data checking. The remaining
  bits are reserved for future use.

 Network job limit - Maximum number of network jobs allowed in the
 system at any time. Not currently implemented.

 Non-paged dynamic  - determines the number of  bytes to allocate for
 the non-paged dynamic pool.

 Virtual non-paged pool - determines the number of bytes to which the
 non-paged pool may be extended.

 Paged dynamic pool - determines the number of bytes to allocate for the
 paged dynamic pool.

 Number of paging files - determines the maximum number of paging files
 that can be made know to the system.

  PAMAXPORT specifies the maximum number of CI ports the CI port driver
  polls for broken port-to-port virtual circuit, or a failed remote node.

 PANOPOLL = 1 surpresses CI polling for ports. If set, a system will not
 discover that another system has shutdown or powered down promptly and will
 not discover a new system that has booted. This parameter is useful when you
 want to bring up a system detached from the rest of the cluster for checkout
 purposes. It is roughly equivalent to uncabling the system from the star
 coupler.
 PANOPOLL = 0 is the normal setting and is required if you are booting from
 an HSC.

 CI port - number of ports to poll each interval.

 CI port - time between poll initiates.

 CI port - time between check for SYSAP's waiting for pool.

 PASANITY controls whether the port sanity timer is enabled to permit
 remote systems to detect a system that has been hung at IPL 7 or above
 for 99 seconds.
 This parameter is normally set to 1 and should only be set to 0 when
 debugging with XDELTA.

 CI port - number of DG buffers to queue for START handshake.

 CI port - timeout between START retries.

 Default page fault cluster size - specifies the maximum number of
 pages which will be read from sections not specifying a cluster factor.
 Also applies to page file pages.

 Page fault rate high threshold - This parameter sets the upper page fault
 rate threshold for automatic working set size incrementing.

 Page fault rate lower threshold - This parameter sets the lower page fault
 rate threshold for automatic working set size decrementing.

 Default AST limit - Default number of pending AST's available to a
 process.

 Minimum AST limit - Minimum number of pending AST's available to a
 process.

 Default buffered I/O limit - Number of buffered I/O requests outstanding
 available to a process.

 Minimum buffered I/O limit - Number of buffered I/O requests outstanding
 available to a process.

 Default buffered I/O byte count limit - Number of bytes allowed in any
 single Buffered I/O request.

 Minimum buffered I/O byte count limit - Number of bytes allowed in any
 single Buffered I/O request.

 Default CPU time limit.

 Minimum CPU time limit.

 Default direct I/O limit - Number of direct I/O requests outstanding
 available to a process.

 Minimum direct I/O limit - Number of direct I/O requests outstanding
 available to a process.

 Default open file limit - Number of open files available to a process.

 Minimum open file limit - Number of open files available to a process.

 Default paging file quota.

 Minimum paging file quota.

 Default sub-process limit - Number of sub-processes available to a process.

 Minimum sub-process limit - Number of sub-processes available to a process.

 Default timer queue entry limit - Number of timer queue entries available
 to a process.

 Minimum timer queue entry limit - Number of timer queue entries available
 to a process.

 Default working set default size.

 Minimum working set default size.

 Default working set quota.

 Minimum working set quota.

 Default working set extent.

 Minimum working set extent.

 Default enqueue limit.

 Minimum enqueue limit.

 Default job-wide logical name table byte quota - Quota allocated to the
 job-wide logical name table on its creation.

 Minimum job-wide logical name table byte quota - Quota allocated to the
 job-wide logical name table on its creation.

 SCS process poller - minimum interval between polls.

 Process section count - guaranteed number of process sections that can
 be created.  Depending on size of working set, the actual number
 of sections can be greater.

 QDSKINTERVAL establishes the disk quorum polling interval in seconds.

 QDSKVOTES specifies the number of votes contributed by a quorum disk in a
 VAXcluster.

 Processor time - Maximum amount of processor time a process can
 receive while other processes are waiting.

                           Note:
    QUORUM has been replaced with the SYSGEN parameter
    EXPECTED_VOTES for VMS Version 5.0.

 Number of SPT entries to preallocate for use by real time processes
 connecting to devices via the connect to interrupt driver - sets the
 number of system page table endries for mapping connect-to-interrups
 process into system space

 Period during which attempts are made to restore a lost connection
 between cluster members.

 Size of resource hash table.

 Remote job limit-defines the maximum number of remote terminals
 allowed in the system at any one time.

 Default multi-block count.

 Default multi-buffer count for sequential disk operations.

 Default multi_buffer count for magtape operations.

 Default multi-buffer count for unit record devices.

 Default multi-buffer count for relative files.

 Default multi-buffer count indexed files.

 Default multi-buffer count hashed.

 Default network transfer block count - determines the default message size
 in disk blocks to be used when performing DECnet file transfer operations.

 Default extend quantity for RMS files.

 Default file protection.

 RMS_GBLBUFQUO specifies the number of global buffers that may be allocated
 on the system at any one time.

 Default prologue level for RMS files.

 If the dump file is saved in the page file, save it until it is
 analyzed.

 SCS allocation counts - Buffer Descriptor Table entries.

 SCS allocation counts - Connect Descriptor Table entries.

SCS flow control cushion.

 SCS maximum datagram size.

 SCS maximum sequenced message size.

 The SCS system node name.

 SCS allocation counts - Response Descriptor Table entries.

 Low longword of the SCS system ID (unique 48 bit number per system).

 High 16 bits of the 48 bit SCS system ID.

 Set time on startup - Forces entry of time at system boot.

   The SHADOWING parameter enables or disables shadowing, and
   specifies the mode of shadowing operations you want to enable.
   SHADOWING is a boolean value that specifies the type of disk class
   driver that is loaded on the system: DUDRIVER, DSDRIVER, and/or
   SHDRIVER. VMS Volume Shadowing on the VMS Version 5.4 operating
   system supports any of the following values:

   o  0-No shadowing is enabled; DUDRIVER is used. This is the
      default value.

   o  1-Phase I shadowing only; DSDRIVER is used. (Phase I shadowing
      is discussed in the VAX Volume Shadowing Manual.) Phase I
      volume shadowing requires HSC controllers with compatible DSA
      disks.

   o  2-Phase II shadowing only; SHDRIVER and DUDRIVER are used.
      Phase II shadowing provides shadowing of all MSCP-compliant DSA
      disks located anywhere on a standalone system or a VAXcluster
      system.

   o  3-Both phase I and phase II shadowing are enabled; SHDRIVER is
      used with DSDRIVER during migrations from phase I to phase II
      volume shadowing.

  See the VMS Volume Shadowing Manual for more information about
  setting SYSGEN parameters for volume shadowing.

   Use this parameter for phase II shadowing only. Set the SHADOW_
   SYS_DISK parameter to zero if the boot device is not a member of a
   phase II shadow set. The default value is zero. Set this parameter
   to 1 if you want to shadow the boot device. All nodes booting off
   a particular system disk shadow set should set their SHADOW_SYS_
   DISK parameter to 1. See the VMS Volume Shadowing Manual for more
   information about setting SYSGEN parameters for volume shadowing.

   Use this parameter for phase II shadowing only. The SHADOW_SYS_
   UNIT parameter is an integer value that contains the virtual unit
   number of the system disk. The default value is zero. The maximum
   value allowed is 9999. This parameter is effective only when the
   SHADOW_SYS_DISK parameter has a value of 1. This parameter should
   be set to the same value on all nodes booting off a particular
   system disk shadow set. See the VMS Volume Shadowing Manual
   for more information about setting SYSGEN parameters for volume
   shadowing.

   Use this parameter for phase II shadowing only. The value of
   SHADOW_MAX_COPY controls how many parallel copy threads are
   allowed on a given node. The value of SHADOW_MAX_COPY can range
   from 0 to 42. The default value is 4. Carefully consider the needs
   of each shadowed VAX when setting this parameter. For example, the
   default value of 4 might be too high for a small satellite node
   and too low for a VAX node with substantial CPU power. Too high
   a value for SHADOW_MAX_COPY can impact performance by allowing
   too many copy threads to operate in parallel. Too low a value
   unnecessarily restricts the number of threads your system can
   effectively handle. See the VMS Volume Shadowing Manual for more
   information about setting SYSGEN parameters for volume shadowing.

  SMP_CPUS identifies which secondary processors, if available,  are to
  be booted into the multiprocessing system at boot time. SMP_CPUS is a
  32-bit mask; if the value of a bit in the mask is  1,  the  processor
  with the corresponding CPU ID  is  booted  into  the  multiprocessing
  system (if it is available).  For example, if you want to  boot  only
  the CPUs with CPU IDs 0 and 1, specify the value 3 (both bits are on).

  The default value of SMP_CPUS, -1,  boots all available CPUs into the
  multiprocessing system.

  Note  that,  although  a  bit  in the mask corresponds to the primary
  processor's CPU ID, the primary processor is always booted.  That is,
  if the mask is set to zero, the primary  CPU  will  still  boot.  Any
  available secondary processors will not be  booted  into  the  multi-
  processing system.

  This parameter is ignored if the MULTIPROCESSING parameter is set  to
  zero.

  Certain shared resources in a multiprocessing system take  longer  to
  become available than allowed for by the SMP_SPINWAIT parameter.  The
  SMP_LNGSPINWAIT parameter establishes, in  10-microsecond  intervals,
  the amount of time a CPU in an SMP system waits for these resources.

  A timeout causes a  CPUSPINWAIT bugcheck.

  The default value of 300,000 10-microsecond intervals (3 seconds)  is
  normally adequate.

  SMP_SANITY_CNT establishes, in 10-millisecond clock ticks, the timeout
  interval for each CPU in a multiprocessing system. Each CPU in an SMP
  system monitors the sanity timer of one other CPU in the configuration
  to detect hardware or software failures. If allowed to go undetected,
  these failures could cause the cluster to hang.

  A timeout causes a CPUSANITY bugcheck.

  The default value of 30 10-millisecond intervals (300 milliseconds) is
  normally adequate.

  SMP_SPINWAIT establishes, in 10-microsecond intervals, the amount  of
  time a CPU normally waits for  access  to  a  shared  resource.  This
  process is called spinwaiting.

  A timeout causes a CPUSPINWAIT bugcheck.

  The default value of 10,000 10-microsecond intervals (100 milliseconds)
  is normally adequate.

 Number of additional system page table entries - the minimum number of
 SPT entries required for mapping various system components.

 Number of small request packets to allocate to the SRP look aside list.

 Virtual IRP count - Number of SRP's to which the SRP list may be extended.

 P1 when set to "MIN" specifies that a minimum sequence of system startup
 procedures are to be performed.
 P2 controls whether verification is set during the execution of a startup
 procedure. A value of "TRUE" maens verification is enabled.
 P3-P8 are reserved for future use.

 Number of swap files - establishes the maximum number of swapfiles that
 can be made known to the system.

 Desired process page count for an outswap swap - This parameter sets the
 number of pages to attempt to reduce a working set to before starting the
 outswap.

 System working set count - establishes the number of pages for the working
 set containing the currently resident pages of pagable system space.

   TAPE_ALLOCCLASS determines the tape allocation class for the system. The
   tape allocation class is used to derive a common lock resource name for
   multiple access paths to the same device.

  TAPE_MVTIMEOUT  is  the  time  in  seconds that a mount verification
  attempt will continue on a given magnetic tape volume.  If the mount
  verification does not recover the volume within that time,  the  I/O
  operations outstanding to the volume will terminate abnormally.

 Time prompt timeout - sets the amount of time to wait for the time of
 day when booting.

 Time between dialup scans - sets the interval for polling terminals for
 dial-up and hang-up events.

 Terminal speed - System wide default speed for terminals.
 Low Byte is Transmit, High byte is receive or 0 indicating the receive
 speed is the same as the transmit speed. See $TTDEF for baud rates.

 Terminal receive speed - Default receive speed. Setting to zero implies
 that TTY_SPEED controls both transmit and receive.

 See the Digital Terminals and Communications Handbook appendix on
 register assignments under LPR register.

 Terminal width - Default terminal line width.

 Default terminal characteristics, and page length - Upper byte is the
 page length. See $TTDEF for bits.

 Default terminal characteristics, second longword - See $TT2DEF for bits.

 Typeahead buffer size - Size of the terminal typeahead buffer.

 Alternate typeahead buffer size.

 Alternate typeahead alarm size - number of remaining characters when
 an XOFF is sent when using alternate typeahead buffer.

 Terminal required DMA size - Minimum size of packet required to do a
 DMA operation within the terminal driver.

 Terminal class name prefix - Two character prefix used in looking up
 the terminal class driver when booting. Useful when debugging a new
 terminal driver.

 Default terminal allocation protection.

 Owner UIC for protection specification -  specifies the owner UIC
 against which the terminal protection is set.

 Flags for dialup:
 Bit 0 is 0 for Normal, 1 for United Kingdom
 Bit 1 controls modem protocol used (other bits reserved for future use).

 Timeout on input silo interrupts for DMF32.

 TTY_TIMEOUT sets the number of seconds before a process associated with a
 disconnected terminal is deleted.

 TTY_AUTOCHAR sets the character the terminal driver echoes when autobaud
completes successfully.

 UDA port burst rate - is one less than the maximum number of longwords
 the host is willing to allow per NPR transfer. Zero implies the port
 should use its own default.

 Select alternate authorization file - causes SYSINIT to make a logical
 name redirecting SYSUAF to SYSUAFALT.

  User-reserved SYSGEN parameters are USERD1, USERD2, USER3 and USER4.
  USERD1 and USERD2 are dynamic parameters.

 Load the code to support a VAX cluster whenever SCS support is present.

 VECTOR_MARGIN establishs the interval of time at which VMS checks
 the status of all vector consumers. The VECTOR_MARGIN parameter
 accepts an integer value between 1 and FFFFFFFF(16). This value
 represents a number of consecutive process quanta (as determined by
 the SYSGEN parameter QUANTUM). If the process has not issued any
 vector instructions in the specified number of quanta, VMS declares
 it a marginal vector consumer.

 The default value of the VECTOR_MARGIN parameter is 200(10).

 VECTOR_PROC controls loading of vector processing support code. By
 default, in a VAX vector processing system, VMS automatically loads
 the vector processing support code at boot time. You can override
 the default behavior by setting the static system parameter
 VECTOR_PROC.

   Settings of VECTOR_PROC System Parameter

   Value  Result

   0      Do not load the vector processing support code, regardless
          of the system configuration.

   1      Load the vector processing support code if there is at
          least one vector-present processor. This is the default
          value.

   2      Load the vector processing support code if the system is
          vector-capable. This setting is most useful for a system in
          which processors have separate power supplies. With this
          setting, you can reconfigure a vector processor into the
          system without rebooting the VMS operating system.

 Maximum virtual page count - determines the total number of pages that
 can be mapped for a process, which can be divided in any fashion
 between P0 and P1 space.

 Number of votes held by the system which can contribute to the
 quorum.

  WINDOW_SYSTEM specifies the windowing system to be used on a workstation.
  Specify one of the following values:

    0       Specifies no workstation environment.  This is the
            default value.

    1       Specifies the VMS DECwindows workstation environment.

    2       Specifies the VMS UIS workstation environment.

 Working set decrement - This parameter sets the number of pages to decrease
 the working set to compensate for a page fault rate below the lower
 threshold.

 Working set increment - This parameter sets the number of pages to increase
 the working set size to compensate for a high page fault rate.

 Maximum size of process working set - determines the system wide maximum
 size of a process working set regardless of process quota.

 WS_OPA0 enables OPA0 output to the QVSS screen for a VAX workstation. A
 value  of "1" enables output for OPA0 to the QVSS screen, a value of "0"
 causes output for OPA0 to be ignored.

 Maximum DR32 data rate - limits the data transfer rate that can be set
 for a DR32.  The larger the value the faster the transfer rate.

  The special system parameters used by DIGITAL. These parameters
  are subject to change at any time and should be modified only by
  DIGITAL personnel.

Additional information available:

CHANNELCNTCONCEAL_DEVICESCTLIMGLIMCTLPAGES
DLCKEXTRASTKEXUSRSTKIMGIOCNTIOTALOCKRETRY
LRPMINMPW_PRIONOAUTOCONFIGNOCLUSTERPAGTBLPFC
PFRATSPHYSICALPAGESPIOPAGESPIXSCANPOOLCHECK
POOLPAGINGPSEUDOLOAQBUS_MULT_INTRRESALLOC
SBIERRENABLESCSI_NOAUTOS0_PAGINGSRPMINSRPSIZE
SSINHIBITSWP_PRIOSWPALLOCINCSWPFAILSWPRATESYSPFC
TBSKIPWSLVMSWRITESYSPARAMSWRITABLESYS

 Permanent I/O channel count - specifies the number of permanent I/O
 channels to provide.

 Set to enable concealed devices.

 CTLIMGLIM specifies the size of the default image I/O segment (channel
 table, initial buffer pool for image-related file/RMS I/O)

 CTLPAGES specifies the size of P1 pool (changed only when the process
 logical name table, DCL symbols, or some layered products, such as UIS,
 require an increase in the size of this area)

 Deadlock extra stack - Amount of extra interrupt stack to leave when
 doing a deadlock search.

 Extra user stack automatically provided by the image activator
 so that the operating system can recover from a stack overflow.

 Default number of pages of image I/O address space used by
 the image activator if not specified at program link time.

 I/O time allowance - This parameter sets the number of 10 millisecond
 units to charge the current residence quantum for each voluntary wait.
 The correct value approximates the cost of a disk I/O neglecting wait time.

 Number of retries to perform when trying to lock a multi-processor
 data structure.

 Minimum allocation request for large request packets.

 Modified page writer I/O priority - This parameter sets the priority of
 I/O transfers initiated by the modified page writer.

 Auto configuration inhibit - inhibits the automatic configuration
 of all devices.

 Clustering inhibit - inhibits all page read clustering.

 Default page table page fault cluster size - specifies the maximum number
 of page tables to attempt to read to satisfy a fault for a non-resident
 page table.

 Page fault rate system threshold - This parameter sets the target system
 page fault threshold. Not currently implemented.

 Maximum number of physical pages to be used - permits testing of smaller
 memory configurations without actually removing memory boards.

 PIOPAGES specifies the size of the process I/O segment  (channel table,
 buffer pool for process permanent file/RMS I/O)

 PIXSCAN specifies the maximum number of computable or
 computable-outswapped processes that can receive a special priority
 boost each second. Only normal priority processes (0-15) are eligible
 for such a boost. The priority boost is implemented to avoid potential
 deadlocks, such as when a process executing below DEFPRI acquires a
 volume lock on a critical disk and cannot release it, because the
 process is unable to access the CPU.

  POOLCHECK tracks the use of pool on the system. This parameter, which
  is disabled by default, is used a debugging aid and is reserved for
  DIGITAL use only.

  Pool paging - Enable paging of pageable dynamic pool.

  PSEUDOLOA specifies (in pages) the size of the PDA0 system image.
  This parameter is used to boot standalone Backup from magnetic tape.

  QBUS_MULT_INTR enables multi-level interrupt dispatching on systems
  that use the Q22 bus.

  Enable resource allocation checking.

 SBI error detection flag - Enables SBI error detection and logging.

  The SCSI_NOAUTO parameter allows a configuration including a SCSI
  third-party device to prevent the loading of a VMS disk or tape SCSI
  class driver for any given device ID.  The SCSI_NOAUTO system parameter
  stores a bit mask of 32 bits, where the low-order byte corresponds to
  the first SCSI bus (PKA0), the second byte corresponds to the second
  SCSI bus (PKB0), and so on, as follows:

        #31   24 23   16 15    8 7     0
        +-------+-------+-------+-------+
        |   D   |   C   |   B   |   A   |
        +-------+-------+-------+-------+

  For each SCSI bus, setting the low-order bit inhibits automatic
  configuration of the device with SCSI device ID 0; setting the second
  low-order bit inhibits automatic configuration of the device with
  SCSI device ID 1, and so forth.  For instance, the value 00002000(hex)
  would prevent the device with SCSI ID  5 on the bus identified by SCSI
  port ID B from being configured.  By default, all of the bits in the
  mask are cleared, allowing all devices to be configured.

  Enables paging of system code.

  Minimum allocation request for small request packets.

  Small request packet size - Number of bytes to allocate to an SRP.

  Set to inhibit system services on a per process basis.

  Swapper I/O priority - This parameter sets the priority of
  I/O transfers initiated by the swapper.

  Swap file allocation increment value - The size in blocks to use to
  backup swap file space allocation in the swap or page file.  Space in
  the file will be allocated multiples of this unit up  to  WSQUOTA  to
  guarantee swap space.

 Swap fail count - This parameter sets the number of consecutive swap
 schedule failures to occur before the swap schedule algorithm changes
 to ignore the swap quantum protection.

 Swap rate control - This parameter sets the swapping rate and serves to
 limit the consumption of disk bandwidth by swapping.

 Page fault cluster for system paging - The number of pages read from disk
 on each system paging operation. Not currently implemented.

 Maximum number of working set list entries that may be skipped while
 scanning for a "good" entry to discard.  Set to 0 to disable skipping.

 Digital reserved SYSGEN parameters are VMSD1, VMSD2, VMSD3, VMSD4,
 VMS5, VMS6, VMS7, and VMS8.

 Parameters were modified during SYSBOOT and will be written out to
 VAXVMSSYS.PAR by STARTUP.COM.

 Leave system writable - for debugging purposes leaves system code
 writable.